Recombinant Human NKAIN2 protein (ab165680)

Overview

  • Product name
    Recombinant Human NKAIN2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGIIRFLLLYCPTNILTVCVLERQIFDFLGYQWAPILANFVHIIIVILGL FGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNI SMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCLLEYQYIEVAHS SLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQL QPMYMSK
    • Amino acids
      1 to 207
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FAM77B
    • Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2
    • Na+/K+ TRANSPORTING ATPase-INTERACTING PROTEIN 2
    • NKAI2_HUMAN
    • NKAIN2
    • NKAIP2
    • Protein FAM77B
    • SODIUM/POTASSIUM TRANSPORTING ATPase-INTERACTING PROTEIN 2
    • Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2
    • T-CELL LYMPHOMA BREAKPOINT-ASSOCIATED TARGET 1;
    • T-cell lymphoma breakpoint-associated target protein 1
    • TCBA1
    see all
  • Tissue specificity
    Expressed in fetal brain. Weakly expressed in adult brain and thymus. Not expressed in any other normal tissue examined.
  • Involvement in disease
    Note=A chromosomal aberration involving NKAIN2 is a cause of lymphoma. Deletion del(6)(q13q21) within NKAIN2 and involving SUSP1 generates the SUSP1-NKAIN2 product.
  • Sequence similarities
    Belongs to the NKAIN family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab165680 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up