Overview

  • Product name
    Recombinant Human NKCC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVV SVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLN VADQKLLE
    • Amino acids
      903 to 1010
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basolateral Na-K-Cl symporter
    • BSC
    • BSC2
    • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1
    • mBSC2
    • MGC104233
    • NKCC1
    • PPP1R141
    • Protein phosphatase 1, regulatory subunit 141
    • S12A2_HUMAN
    • Slc12a2
    • sodium-potassium-chloride cotransporter 1
    • Solute carrier family 12 (sodium/potassium/chloride transporter), member 2
    • solute carrier family 12 (sodium/potassium/chloride transporters) member 2
    • Solute carrier family 12 member 2
    • sy-ns
    see all
  • Function
    Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
  • Tissue specificity
    Expressed in many tissues.
  • Sequence similarities
    Belongs to the SLC12A transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159532 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up