Recombinant Human NKF3 kinase family member protein (ab164128)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TPPPLPKKMIIRANTEPISKDLQKSMESSLCVMANPTYDIDPNWDASSAG SSISYELKGLDIESYDSLERPLRKERPVPSAANSISSLTTLSIKDRFSNS
    • Amino acids
      1151 to 1250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ21140
    • FLJ34483
    • KIAA2002
    • NKF3 kinase family member
    • PEAK1
    • PEAK1_HUMAN
    • pseudopodium enriched atypical kinase
    • Pseudopodium-enriched atypical kinase 1
    • SGK269
    • Sugen kinase 269
    • Tyrosine-protein kinase SgK269
    see all
  • Function
    Tyrosine kinase that may play a role in cell spreading and migration on fibronectin. May directly or indirectly affect phosphorylation levels of cytoskeleton-associated proteins MAPK1/ERK and PXN.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine in a CSK-dependent manner in response to adhesion to fibronectin and to EGF stimulation. Autophosphorylated in vitro.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Colocalizes with F-actin in serum-rich medium. Actin colocalization is reduced during serum starvation.
  • Information by UniProt

Images

  • ab164128 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up