Recombinant human NKF3 kinase family member protein (ab177257)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KGAVDDAIAFGGKTDQEAPNASQPTPPPLPKKMIIRANTEPISKDLQKSM ESSLCVMANPTYDIDPNWDASSAGSSISYELKGLDIESYDSLERPLRKER PVPSAANSISSLTTLSIKDRFSNSMESLSSRRGPSCRQGRGIQKPQRQAL YRGLENREEVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFGVDSWSD FRLTSDKPCCEAGDAVYYTASYAKDPLNNYAVKICKSKAKESQQYYHSLA VRQSLAVHFNIQQDCGHFLAEVPNRLLPWEDPDDPEKDEDDMEETEEDAK GETDGKNPKPCSEAASSQKENQGVMSKKQRSHVVVITREVPCLTVADFVR DSLAQHGKSPDLYERQVCLLLLQLCSGLEHLKPYHVTHCDLRLENLLLVH YQPGGTAQGFGPAEPSPTSSYPTRLIVSNFSQAKQKSHLVDPEILRDQSR LAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENPELKEREYTRADLP RIPFRSPYSRGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQ TFTACPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQ YLAFATTDSLSCIVKILQHR
    • Molecular weight
      100 kDa including tags
    • Amino acids
      1127 to 1746
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab177257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    6 nmol/min/mg

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Additional notes

    It is recommended to store this protein at -80°C in glycerol to preserve the activity of the protein.

    ab204877 (Poly (4:1 Glu, Tyr) peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • FLJ21140
    • FLJ34483
    • KIAA2002
    • NKF3 kinase family member
    • PEAK1
    • PEAK1_HUMAN
    • pseudopodium enriched atypical kinase
    • Pseudopodium-enriched atypical kinase 1
    • SGK269
    • Sugen kinase 269
    • Tyrosine-protein kinase SgK269
    see all
  • Function
    Tyrosine kinase that may play a role in cell spreading and migration on fibronectin. May directly or indirectly affect phosphorylation levels of cytoskeleton-associated proteins MAPK1/ERK and PXN.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine in a CSK-dependent manner in response to adhesion to fibronectin and to EGF stimulation. Autophosphorylated in vitro.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Colocalizes with F-actin in serum-rich medium. Actin colocalization is reduced during serum starvation.
  • Information by UniProt

Images

  • The specific activity of ab177257 was determined to be 6 nmol/min/mg.

     

  • SDS-PAGE analysis of ab177257.

References

ab177257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up