Recombinant Human NKIAMRE protein (ab172189)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMRE IKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESK RLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTL AAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPY LPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARK KYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELK AKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKE KKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKL VTIEPPNPINPSTNCNGLKENPHCGGSVTMPPINLTNSNLMAANLSSNLF HPSVRLTERAKKRRTSSQSIGQVMPNSRQEDPGPIQSQMEKGIFNERTGH SDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGMEVKQIKMLKRE SKKTESSKIPTLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW
    • Molecular weight
      68 kDa
    • Amino acids
      1 to 592
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 70 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names
    • CDKL3
    • CDKL3 protein
    • CDKL3_HUMAN
    • Cyclin dependent kinase like 3
    • Cyclin-dependent kinase-like 3
    • Serine/threonine-protein kinase NKIAMRE
    see all
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The [NKR]KIAxRE motif seems to be a cyclin-binding region.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172189.

References

ab172189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up