Recombinant Human Nkx2.2 protein (ab152573)

Overview

  • Product name
    Recombinant Human Nkx2.2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKP CHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHP LVQAQQW
    • Molecular weight
      38 kDa including tags
    • Amino acids
      165 to 271

Specifications

Our Abpromise guarantee covers the use of ab152573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeobox protein NK 2 homolog B
    • Homeobox protein NK-2 homolog B
    • Homeobox protein Nkx 2.2
    • Homeobox protein Nkx-2.2
    • NK 2 homolog B
    • NK2 homeobox 2
    • NK2 transcription factor like protein B
    • NK2 transcription factor related locus 2
    • NKX2 2
    • NKX2-2
    • NKX22
    • NKX22_HUMAN
    • Nkx2b
    • tinman
    see all
  • Function
    May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance.
  • Sequence similarities
    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Domain
    The homeodomain is essential for interaction with OLIG2.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152573 stained with Coomassie Blue.

References

ab152573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up