Recombinant Human Nkx2.5 protein (ab152305)

Overview

  • Product name
    Recombinant Human Nkx2.5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAA FKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDP DPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQV YELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQ TLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGY NAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDL NAVQSPGIPQSNSGVSTLHGIRAW
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 324

Specifications

Our Abpromise guarantee covers the use of ab152305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NKX2.5, mouse, homolog of
    • Cardiac-specific homeobox
    • Cardiac-specific homeobox 1
    • CHNG5
    • CSX
    • CSX1
    • FLJ52202
    • FLJ97166
    • FLJ97195
    • FLJ97197
    • FLJ99536
    • HLHS2
    • Homeobox protein CSX
    • Homeobox protein NK-2 homolog E
    • Homeobox protein Nkx 2.5
    • Homeobox protein Nkx-2.5
    • NK2 homeobox 5
    • NK2 transcription factor related locus 5
    • NK2 transcription factor related, locus 5 (Drosophila)
    • NK2, Drosophila, homolog of, E
    • NKX2-5
    • NKX2.5
    • NKX25_HUMAN
    • Nkx2E
    • NKX4-1
    • Tinman paralog
    • VSD3
    see all
  • Function
    Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4 (By similarity). It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B (By similarity). It is required for spleen development.
  • Tissue specificity
    Expressed only in the heart.
  • Involvement in disease
    Atrial septal defect 7, with or without atrioventricular conduction defects
    Tetralogy of Fallot
    Conotruncal heart malformations
    Hypothyroidism, congenital, non-goitrous, 5
    Ventricular septal defect 3
    Hypoplastic left heart syndrome 2
    Asplenia, isolated congenital
  • Sequence similarities
    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152305 stained with Coomassie Blue.

References

ab152305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up