Recombinant Human Nkx3.1 protein (ab114523)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99801
    • SpeciesHuman
    • SequenceGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYL SAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPA LKEEAFSRAS
    • Molecular weight38 kDa including tags
    • Amino acids100 to 209

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BAPX 2
    • BAPX2
    • Homeobox protein NK-3 homolog A
    • Homeobox protein Nkx 3.1
    • Homeobox protein Nkx-3.1
    • Homeobox protein Nkx3.1
    • NK homeobox (Drosophila) family 3 A
    • NK homeobox family 3 A
    • NK homeobox, family 3, member A
    • NK3 homeobox 1
    • NK3 transcription factor homolog A
    • NK3 transcription factor related locus 1
    • NKX 3
    • Nkx 3.1
    • NKX 3A
    • NKX3
    • NKX3 1
    • Nkx3-1
    • NKX3.1
    • Nkx3.1, mouse, homolog of
    • NKX31_HUMAN
    • NKX3A
    see all
  • FunctionTranscription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Play an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.
  • Tissue specificityHighly expressed in the prostate and, at a lower level, in the testis.
  • Sequence similaritiesBelongs to the NK-3 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications
    Ubiquitinated by TOPORS; monoubiquitinated at several residues and also polyubiquitinated on single residues.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Nkx3.1 protein images

  • 12.5% SDS-PAGE showing ab114523 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human Nkx3.1 protein (ab114523)

ab114523 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"