Recombinant Human NLGN4X protein (ab163571)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTR RSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS
    • Amino acids
      577 to 676
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASPGX2
    • AUTSX2
    • HLNX
    • HNL4X
    • HNLX
    • KIAA1260
    • neuroligin 4, X-linked
    • Neuroligin X
    • Neuroligin-4
    • NL4
    • NLGN
    • NLGN4
    • NLGN4X
    • NLGNX_HUMAN
    • OTTHUMP00000022863
    • OTTHUMP00000022864
    • OTTHUMP00000022865
    • X-linked
    see all
  • Function
    Putative neuronal cell surface protein involved in cell-cell-interactions.
  • Tissue specificity
    Expressed at highest levels in heart. Expressed at lower levels in liver, skeletal muscle and pancreas and at very low levels in brain.
  • Involvement in disease
    Defects in NLGN4X may be the cause of susceptibility to autism X-linked type 2 (AUTSX2) [MIM:300495]. AUTSX2 is a pervasive developmental disorder (PDD), prototypically characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age.
    Defects in NLGN4X may be the cause of susceptibility to X-linked Asperger syndrome 2 (ASPGX2) [MIM:300497]. ASPGX2 is considered to be a form of childhood autism.
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163571 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up