Recombinant Human NLGN4Y protein (ab167730)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QYPVVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPES PSSWTGIRNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQN EDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASY GNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGG DPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQP AKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPV IDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVT PNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLV ALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGD EVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVP QDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWL ELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAI TPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS
    • Molecular weight
      72 kDa including tags
    • Amino acids
      44 to 676

Specifications

Our Abpromise guarantee covers the use of ab167730 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS
    Note: Normally Mannitol or Trehalose are added as protectants before lyophilization.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 50µl sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Neuroligin Y
    • Neuroligin-4
    • NLGN4Y
    • NLGNY_HUMAN
    • Y-linked
    see all
  • Function
    Putative neuronal cell surface protein involved in cell-cell-interactions.
  • Tissue specificity
    Expressed in fetal and adult brain, prostate and testis.
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab167730 stained overnight with Coomassie Blue.

References

ab167730 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167730.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up