Overview

  • Product name
    Recombinant Human NLN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRW DLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYI VERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMSMRGDIFERIVHLQ ETCDLGKIKPEARRYLEKSIKMGKRNGLHLPEQVQNEIKSMKKRMSELCI DFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFP VMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGF EYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQEL LGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAA CFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFG HVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLSKHYK DGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSC FKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRG LHAP
    • Amino acids
      1 to 704
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGTBP
    • Angiotensin binding protein
    • Angiotensin-binding protein
    • DKFZp564F123
    • EC 3.4.24.16
    • EP24.16
    • FLJ23002
    • KIAA1226
    • MEP
    • Microsomal endopeptidase
    • mitochondrial
    • Mitochondrial oligopeptidase M
    • MOP
    • NEUL_HUMAN
    • Neurolysin
    • neurolysin (metallopeptidase M3 family)
    • Neurolysin, mitochondrial precursor
    • Neurotensin endopeptidase
    • Nln
    see all
  • Function
    Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.
  • Sequence similarities
    Belongs to the peptidase M3 family.
  • Cellular localization
    Mitochondrion intermembrane space. Cytoplasm.
  • Information by UniProt

Images

  • ab163565 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up