Recombinant Human NLRP11 protein (ab165907)

Overview

  • Product name
    Recombinant Human NLRP11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAESDSTDFDLLWYLENLSDKEFQSFKKYLARKILDFKLPQFPLIQMTKE ELANVLPISYEGQYIWNMLFSIFSMMRKEDLCRKIIGRRNRNQEACKAVM RRKFMLQWESHTFGKFHYKFFRDVSSDVFYILQLAYDSTSYYSANNLNVF LMGERASGKTIVINLAVLRWIKGEMWQNMISYVVHLTSHEINQMTNSSLA ELIAKDWPDGQAPIADILSDPKKLLFILEDLDNIRFELNVNESALCSNST QKVPIPVLLVSLLKRKMAPGCWFLISSRPTRGNNVKTFLKEVDCCTTLQL SNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVAILCWITCTVLK RQMDKGRDFQLCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCLL AAGGLFLSTLNFSGEDLRCVGFTEADVSVLQAANILLPSNTHKDRYKFIH LNVQEFCTAIAFLMAVPNYLIPSGSREYKEKREQYSDFNQVFTFIFGLLN ANRRKILETSFGYQLPMVDSFKWYSVGYMKHLDRDPEKLTHHMPLFYCLY ENREEEFVKTIVDALMEVTVYLQSDKDMMVSLYCLDYCCHLRTLKLSVQR IFQNKEPLIRPTASQMKSLVYWREICSLFYTMESLRELHIFDNDLNGISE RILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTS ISLNMFSLLHDILHEPTCQISHLSLMKCDLRASECEEIASLLISGGSLRK LTLSSNPLRSDGMNILCDALLHPNCTLISLVLVFCCLTENCCSALGRVLL FSPTLRQLDLCVNRLKNYGVLHVTFPLLFPTCQLEELHLSGCFFSSDICQ YIAIVIATNEKLRSLEIGSNKIEDAGMQLLCGGLRHPNCMLVNIGLEECM LTSACCRSLASVLTTNKTLERLNLLQNHLGNDGVAKLLESLISPDCVLKV VGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPG SIIPNSNLDYMFFKFPRMSAAMRTSNTASRQPL
    • Amino acids
      1 to 1033
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLR19.6
    • FLJ26273
    • NACHT leucine rich repeat and PYD containing 11
    • NACHT LRR and PYD domains containing protein 11
    • NACHT, LRR and PYD domains-containing protein 11
    • NAL11_HUMAN
    • NALP11
    • NLR family pyrin domain containing 11
    • NLRP11
    • NOD17
    • Nucleotide binding oligomerization domain protein 17
    • Nucleotide-binding oligomerization domain protein 17
    • Nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 11
    • PAAD and NACHT containing protein 10B
    • PAAD and NACHT domain containing protein 10
    • PAAD-and NACHT domain-containing protein 10
    • PAN10
    • PYPAF6
    • PYPAF7
    • PYRIN containing APAF1 like protein 6
    • PYRIN-containing APAF1-like protein 6
    see all
  • Function
    Involved in inflammation.
  • Sequence similarities
    Belongs to the NLRP family.
    Contains 1 DAPIN domain.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Information by UniProt

Images

  • ab165907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up