Recombinant Human NMDAR1 protein (ab158584)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPN AIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
    • Amino acids
      21 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GluN1
    • Glutamate [NMDA] receptor subunit zeta-1
    • Glutamate receptor ionotropic N methyl D aspartate 1
    • Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1
    • glutamate receptor ionotropic, NMDA 1
    • Grin1
    • MRD8
    • N methyl D aspartate receptor
    • N methyl D aspartate receptor channel subunit zeta 1
    • N methyl D aspartate receptor subunit NR1
    • N-methyl-D-aspartate receptor subunit NR1
    • NMD-R1
    • NMDA 1
    • NMDA R1
    • NMDA receptor 1
    • NMDA1
    • NMDAR
    • NMDZ1_HUMAN
    • NR1
    see all
  • Function
    NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR1/GRIN1 subfamily.
  • Post-translational
    modifications
    NMDA is probably regulated by C-terminal phosphorylation of an isoform of NR1 by PKC. Dephosphorylated on Ser-897 probably by protein phosphatase 2A (PPP2CB). Its phosphorylated state is influenced by the formation of the NMDAR-PPP2CB complex and the NMDAR channel activity.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in post-synaptic plasma membrane and post-synaptic densities.
  • Information by UniProt

Images

  • ab158584 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158584 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up