Recombinant Human NMDAR2B protein (ab112298)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYF PGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSP IILLYCTKEE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      127 to 236
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • AW490526
    • EIEE27
    • Glutamate [NMDA] receptor subunit epsilon 2
    • Glutamate [NMDA] receptor subunit epsilon-2
    • Glutamate Receptor Ionotropic N Methyl D Aspartate 2B
    • Glutamate Receptor Ionotropic N Methyl D Aspartate subunit 2B
    • Glutamate receptor ionotropic NMDA2B
    • Glutamate receptor subunit epsilon 2
    • Glutamate receptor, ionotropic, NMDA2B (epsilon 2)
    • GRIN 2B
    • GRIN2B
    • hNR 3
    • hNR3
    • MGC142178
    • MGC142180
    • MRD6
    • N methyl D asparate receptor channel subunit epsilon 2
    • N methyl D aspartate receptor subtype 2B
    • N methyl D aspartate receptor subunit 2B
    • N methyl D aspartate receptor subunit 3
    • N-methyl D-aspartate receptor subtype 2B
    • N-methyl-D-aspartate receptor subunit 3
    • NMDA NR2B
    • NMDA R2B
    • NMDAR2B
    • NMDE2
    • NMDE2_HUMAN
    • NME2
    • NR2B
    • NR3
    see all
  • Function
    NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
  • Tissue specificity
    Primarily found in the fronto-parieto-temporal cortex and hippocampus pyramidal cells, lower expression in the basal ganglia.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab112298 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab112298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up