Recombinant Human NMDAR2B protein (ab112298)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13224
    • SpeciesHuman
    • SequenceHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYF PGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSP IILLYCTKEE
    • Molecular weight38 kDa including tags
    • Amino acids127 to 236
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • AW490526
    • EIEE27
    • Glutamate [NMDA] receptor subunit epsilon 2
    • Glutamate [NMDA] receptor subunit epsilon-2
    • Glutamate Receptor Ionotropic N Methyl D Aspartate 2B
    • Glutamate Receptor Ionotropic N Methyl D Aspartate subunit 2B
    • Glutamate receptor ionotropic NMDA2B
    • Glutamate receptor subunit epsilon 2
    • Glutamate receptor, ionotropic, NMDA2B (epsilon 2)
    • GRIN 2B
    • GRIN2B
    • hNR 3
    • hNR3
    • MGC142178
    • MGC142180
    • MRD6
    • N methyl D asparate receptor channel subunit epsilon 2
    • N methyl D aspartate receptor subtype 2B
    • N methyl D aspartate receptor subunit 2B
    • N methyl D aspartate receptor subunit 3
    • N-methyl D-aspartate receptor subtype 2B
    • N-methyl-D-aspartate receptor subunit 3
    • NMDA NR2B
    • NMDA R2B
    • NMDAR2B
    • NMDE2
    • NMDE2_HUMAN
    • NME2
    • NR2B
    • NR3
    see all
  • FunctionNMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
  • Tissue specificityPrimarily found in the fronto-parieto-temporal cortex and hippocampus pyramidal cells, lower expression in the basal ganglia.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.
  • Cellular localizationCell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Recombinant Human NMDAR2B protein images

  • ab112298 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human NMDAR2B protein (ab112298)

ab112298 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"