Recombinant Human NMDAR2C protein (ab114505)

Overview

  • Product name
    Recombinant Human NMDAR2C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARL TPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVD TEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRL GSGVLWFWEAGIRRDGQGGGG
    • Molecular weight
      45 kDa including tags
    • Amino acids
      1 to 133
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GluN2C
    • Glutamate [NMDA] receptor subunit epsilon-3
    • Glutamate Receptor Ionotropic N Methyl D Aspartate 2C
    • Glutamate receptor ionotropic, NMDA 2C
    • Glutamate receptor, ionotropic, N methyl D aspartate 2C
    • Grin2c
    • N Methly D Aspartate Receptor Channel Subunit Epsilon 3
    • N Methyl D Aspartate Receptor Subtype 2C
    • N methyl D aspartate receptor subunit 2C
    • N-methyl D-aspartate receptor subtype 2C
    • NMDAR2C
    • NMDE3_HUMAN
    • NR2C
    • OTTHUMP00000041930
    see all
  • Function
    NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
  • Tissue specificity
    Mainly expressed in brain with predominant expression is in the cerebellum, also present in the hippocampus, amygdala, caudate nucleus, corpus callosum, subthalamic nuclei and thalamus. Detected in the heart, skeletal muscle and pancreas.
  • Sequence similarities
    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2C/GRIN2C subfamily.
  • Cellular localization
    Cell membrane. Cell junction, synapse, postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab114505 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up