Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGF KLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDV VRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALW FRADELLCWEDSAGHWLYE
    • Molecular weight
      19 kDa including tags
    • Amino acids
      22 to 169
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103051 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • c371H6.2
    • DR-nm23
    • Expressed in non metastatic cells 3
    • NDK 3
    • NDK3
    • NDK3_HUMAN
    • NDP kinase 3
    • NDP kinase C
    • NDPK C
    • NDPKC
    • NM23 H3
    • nm23-H3
    • NM23H3
    • NME 3
    • NME/NM23 nucleoside diphosphate kinase 3
    • Nme3
    • Non metastatic cells 3 protein expressed in
    • Nucleoside diphosphate kinase 3
    • Nucleoside diphosphate kinase C
    see all
  • Function
    Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
  • Sequence similarities
    Belongs to the NDK family.
  • Developmental stage
    Preferentially expressed at early stages of myeloid differentiation of highly purified CD34+ cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103051

References

ab103051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up