Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13232
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGF KLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDV VRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALW FRADELLCWEDSAGHWLYE
    • Molecular weight19 kDa including tags
    • Amino acids22 to 169
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103051 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • c371H6.2
    • DR-nm23
    • Expressed in non metastatic cells 3
    • NDK 3
    • NDK3
    • NDK3_HUMAN
    • NDP kinase 3
    • NDP kinase C
    • NDPK C
    • NDPKC
    • NM23 H3
    • nm23-H3
    • NM23H3
    • NME 3
    • NME/NM23 nucleoside diphosphate kinase 3
    • Nme3
    • Non metastatic cells 3 protein expressed in
    • Nucleoside diphosphate kinase 3
    • Nucleoside diphosphate kinase C
    see all
  • FunctionMajor role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis.
  • Sequence similaritiesBelongs to the NDK family.
  • Developmental stagePreferentially expressed at early stages of myeloid differentiation of highly purified CD34+ cells.
  • Information by UniProt

Recombinant Human NME3 protein images

  • 15% SDS-PAGE analysis of 3µg ab103051

References for Recombinant Human NME3 protein (ab103051)

ab103051 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"