Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRF ERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVW EGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQR EIQLWFQSSELVSWADGGQHSSIHPA
    • Molecular weight
      20 kDa including tags
    • Amino acids
      33 to 187
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107133 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • metastatic inhibition factor NM23H4
    • mitochondrial
    • NDK
    • NDKM_HUMAN
    • NDP kinase
    • NDP kinase D
    • NDP kinase, mitochondrial
    • NDPK D
    • NDPKD
    • nm23 H4
    • nm23-H4
    • NM23D
    • NM23H4
    • Nm23M4
    • NME/NM23 nucleoside diphosphate kinase 4
    • NME4
    • Non metastatic cells 4 protein expressed in
    • Non metastatic protein 23, homolog 4
    • Nucleoside diphosphate kinase D
    • Nucleoside diphosphate kinase, mitochondrial
    see all
  • Function
    Major role in the synthesis of nucleoside triphosphates other than ATP.
  • Tissue specificity
    Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
  • Sequence similarities
    Belongs to the NDK family.
  • Cellular localization
    Mitochondrion intermembrane space.
  • Information by UniProt

Recombinant Human NME4 protein images

  • 15% SDS-PAGE showing ab107133 (3µg).

References for Recombinant Human NME4 protein (ab107133)

ab107133 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up