Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPSWTRERTLVAVKPDGVQRRLVGDVIQRF ERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVW EGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQR EIQLWFQSSELVSWADGGQHSSIHPA
    • Molecular weight
      20 kDa including tags
    • Amino acids
      33 to 187
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107133 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • metastatic inhibition factor NM23H4
    • mitochondrial
    • NDK
    • NDKM_HUMAN
    • NDP kinase
    • NDP kinase D
    • NDP kinase, mitochondrial
    • NDPK D
    • NDPKD
    • nm23 H4
    • nm23-H4
    • NM23D
    • NM23H4
    • Nm23M4
    • NME/NM23 nucleoside diphosphate kinase 4
    • NME4
    • Non metastatic cells 4 protein expressed in
    • Non metastatic protein 23, homolog 4
    • Nucleoside diphosphate kinase D
    • Nucleoside diphosphate kinase, mitochondrial
    see all
  • Function
    Major role in the synthesis of nucleoside triphosphates other than ATP.
  • Tissue specificity
    Widely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
  • Sequence similarities
    Belongs to the NDK family.
  • Cellular localization
    Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107133 (3µg).

References

ab107133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up