Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLS PEQCSNFYVEKYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPN NSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPEVIVEP IPIGRAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKP KLCHHPIVEEPY
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Inhibitor of p53 induced apoptosis beta
    • Inhibitor of p53-induced apoptosis-beta
    • IPIA beta
    • IPIA-beta
    • NDK-H 5
    • NDK5_HUMAN
    • NDP kinase homolog 5
    • NM23 H5
    • nm23-H5
    • Nm23-M5
    • NM23H5
    • NME/NM23 family member 5
    • NME5
    • Non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
    • Nonmetastatic cells 5, protein expressed in
    • Nonmetastatic protein 23, homolog 5
    • Nucleoside diphosphate kinase homolog 5
    • Radial spoke 23 homolog
    • RSPH23
    • Testis specific nm23 homolog
    • Testis-specific nm23 homolog
    see all
  • Function
    Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.
  • Tissue specificity
    Specifically expressed in testis germinal cells.
  • Sequence similarities
    Belongs to the NDK family.
  • Information by UniProt

Images

  • ab160010 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up