Overview

  • Product name
    Recombinant Human NME6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFL IVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAI QLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIA AFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
    • Amino acids
      1 to 194
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Inhibitor of p53 induced apoptosis alpha
    • Inhibitor of p53-induced apoptosis-alpha
    • IPIA ALPHA
    • IPIA-alpha
    • NDK 6
    • NDK6_HUMAN
    • NDP kinase 6
    • NM23 H6
    • nm23-H6
    • NM23H6
    • Nme6
    • Nucleoside diphosphate kinase 6
    • OTTHUMP00000164810
    • OTTHUMP00000210736
    • OTTHUMP00000210737
    • OTTHUMP00000210738
    • OTTHUMP00000210741
    • OTTHUMP00000210742
    • OTTHUMP00000210744
    • OTTHUMP00000210745
    see all
  • Function
    Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis.
  • Tissue specificity
    Expressed at a moderately low level in many tissues. Most abundant in kidney, prostate, ovary, intestine, and spleen.
  • Sequence similarities
    Belongs to the NDK family.
  • Information by UniProt

Images

  • ab160872 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up