Recombinant Human NMNAT3 protein (ab153644)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQ AQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGAD VLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQH NIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGS TWKGKSTQSTEGKTS
    • Amino acids
      1 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NaMN adenylyltransferase 3
    • Nicotinamide mononucleotide adenylyltransferase 3
    • Nicotinamide nucleotide adenylyltransferase 3
    • Nicotinate-nucleotide adenylyltransferase 3
    • NMN adenylyltransferase 3
    • NMNA3_HUMAN
    • NMNAT 3
    • Nmnat3
    • PNAT 3
    • PNAT-3
    • PNAT3
    • Pyridine nucleotide adenylyltransferase 3
    see all
  • Function
    Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Can also use GTP and ITP as nucleotide donors. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, can use NAD (+), NADH, NAAD, nicotinic acid adenine dinucleotide phosphate (NHD), nicotinamide guanine dinucleotide (NGD) as substrates. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following injury.
  • Tissue specificity
    Expressed in lung and spleen with lower levels in placenta and kidney.
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; NAD(+) from nicotinamide D-ribonucleotide: step 1/1.
  • Sequence similarities
    Belongs to the eukaryotic NMN adenylyltransferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab153644 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up