Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPAN DTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFS VGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPY TLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWA LRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCV HKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRS LNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSF YTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVF NALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ
    • Amino acids
      1 to 496
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alternative, short form NMT S
    • EC 2.3.1.97
    • Glycylpeptide N tetradecanoyltransferase 1
    • Glycylpeptide N-tetradecanoyltransferase 1
    • Long form, NMT L
    • Myristoyl CoA:protein N myristoyltransferase 1
    • Myristoyl-CoA:protein N-myristoyltransferase 1
    • N myristoyltransferase 1
    • NMT
    • NMT 1
    • nmt1
    • NMT1_HUMAN
    • Peptide N myristoyltransferase 1
    • Peptide N-myristoyltransferase 1
    • Type I N myristoyltransferase
    • Type I N-myristoyltransferase
    see all
  • Function
    Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
  • Tissue specificity
    Heart, gut, kidney, liver and placenta.
  • Sequence similarities
    Belongs to the NMT family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159004 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up