Recombinant Human NNT1 protein (denatured) (ab111634)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UBD9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRS LAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQN YEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGY PLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLK KKMQPPAAAVTLHLGAHGF
    • Molecular weight25 kDa including tags
    • Amino acids28 to 225
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 3.50
    Constituents: 10% Glycerol, 2.4% Urea, 0.59% Sodium citrate

General Info

  • Alternative names
    • B cell stimulating factor 3
    • B-cell-stimulating factor 3
    • BSF 3
    • BSF-3
    • BSF3
    • Cardiotrophin like cytokine
    • Cardiotrophin like cytokine factor 1
    • Cardiotrophin-like cytokine factor 1
    • CISS 2
    • CISS2
    • CLC
    • CLCF 1
    • Clcf1
    • CLCF1_HUMAN
    • Cold induced sweating syndrome 2
    • CRLF 1 associated cytokine like factor 1
    • CRLF1 associated cytokine like factor 1
    • Neurotrophin 1
    • Neurotrophin 1/B cell stimulating factor 3
    • Neurotrophin1
    • NNT 1
    • NNT-1
    • Novel neurotrophin 1
    • Novel neurotrophin-1
    • NR 6
    • NR6
    see all
  • FunctionCytokine with B-cell stimulating capability. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificityExpressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
  • Involvement in diseaseDefects in CLCF1 are the cause of cold-induced sweating syndrome type 2 (CISS2) [MIM:610313]. Cold-induced sweating syndrome (CISS) is an autosomal recessive disorder characterized by profuse sweating induced by cool surroundings (temperatures of 7 to 18 degrees Celsius). Additional abnormalities include a high-arched palate, nasal voice, depressed nasal bridge, inability to fully extend the elbows and kyphoscoliosis.
  • Sequence similaritiesBelongs to the IL-6 superfamily.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human NNT1 protein (denatured) images

  • 15% SDS-PAGE showing ab111634 at approximately 24.6kDa (3µg).

References for Recombinant Human NNT1 protein (denatured) (ab111634)

ab111634 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"