Recombinant Human NNT1 protein (denatured) (ab111634)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRS LAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQN YEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGY PLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLK KKMQPPAAAVTLHLGAHGF
    • Molecular weight
      25 kDa including tags
    • Amino acids
      28 to 225
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 3.50
    Constituents: 10% Glycerol, 2.4% Urea, 0.59% Sodium citrate

General Info

  • Alternative names
    • B cell stimulating factor 3
    • B-cell-stimulating factor 3
    • BSF 3
    • BSF-3
    • BSF3
    • Cardiotrophin like cytokine
    • Cardiotrophin like cytokine factor 1
    • Cardiotrophin-like cytokine factor 1
    • CISS 2
    • CISS2
    • CLC
    • CLCF 1
    • Clcf1
    • CLCF1_HUMAN
    • Cold induced sweating syndrome 2
    • CRLF 1 associated cytokine like factor 1
    • CRLF1 associated cytokine like factor 1
    • Neurotrophin 1
    • Neurotrophin 1/B cell stimulating factor 3
    • Neurotrophin1
    • NNT 1
    • NNT-1
    • Novel neurotrophin 1
    • Novel neurotrophin-1
    • NR 6
    • NR6
    see all
  • Function
    Cytokine with B-cell stimulating capability. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificity
    Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
  • Involvement in disease
    Defects in CLCF1 are the cause of cold-induced sweating syndrome type 2 (CISS2) [MIM:610313]. Cold-induced sweating syndrome (CISS) is an autosomal recessive disorder characterized by profuse sweating induced by cool surroundings (temperatures of 7 to 18 degrees Celsius). Additional abnormalities include a high-arched palate, nasal voice, depressed nasal bridge, inability to fully extend the elbows and kyphoscoliosis.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111634 at approximately 24.6kDa (3µg).

References

ab111634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up