Recombinant Human NOB1 protein (denatured) (ab171677)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAPVEHVVADAGAFLRHAALQDIGKNI YTIREVVTEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYP SLSATDIQVLALTYQLEAEFVGVSHLKQEPQKVKVSSSIQHPETPLHISG FHLPYKPKPPQETEKGHSACEPENLEFSSFMFWRNPLPNIDHELQELLID RGEDVPSEEEEEEENGFEDRKDDSDDDGGGWITPSNIKQIQQELEQCDVP EDVRVGCLTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTT SDMSRVFCSHCGNKTLKKVSVTVSDDGTLHMHFSRNPKVLNPRGLRYSLP TPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVEND ISSRSATLQVRDSTLGAGRRRLNPNASRKKFVKKR
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 412
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Adenocarcinoma antigen recognized by T lymphocytes 4
    • ART 4
    • ART4
    • MST158
    • MSTP158
    • Nin one binding protein
    • NIN1/PSMD8 binding protein 1 homolog
    • NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)
    • nob1
    • NOB1_HUMAN
    • NOB1P
    • Phosphorylation regulatory protein HP-10
    • Protein ART-4
    • Protein ART4
    • PSMD8 binding protein 1
    • PSMD8BP1
    • RNA binding protein NOB1
    • RNA-binding protein NOB1
    see all
  • Function
    May play a role in mRNA degradation.
  • Tissue specificity
    Detected in liver, lung, placenta, endothelial cells and spleen.
  • Sequence similarities
    Belongs to the NOB1 family.
    Contains 1 PINc domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171677 (3µg).

References

ab171677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up