Overview

  • Product name
    Recombinant Human NOC2L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAGSRKRRLAELTVDEFLASGFDSESESESENSPQAETREAREAARSP DKPGGSPSASRRKGRASEHKDQLSRLKDRDPEFYKFLQENDQSLLNFSDS DSSEEEEGPFHSLPDVLEEASEEEDGAEEGEDGDRVPRGLKGKKNSVPVT VAMVERWKQAAKQRLTPKLFHEVVQAFRAAVATTRGDQESAEANKFQVTD SAAFNALVTFCIRDLIGCLQKLLFGKVAKDSSRMLQPSSSPLWGKLRVDI KAYLGSAIQLVSCLSETTVLAAVLRHISVLVPCFLTFPKQCRMLLKRMVV VWSTGEESLRVLAFLVLSRVCRHKKDTFLGPVLKQMYITYVRNCKFTSPG ALPFISFMQWTLTELLALEPGVAYQHAFLYIRQLAIHLRNAMTTRKKETY QSVYNWQYVHCLFLWCRVLSTAGPSEALQPLVYPLAQVIIGCIKLIPTAR FYPLRMHCIRALTLLSGSSGAFIPVLPFILEMFQQVDFNRKPGRMSSKPI NFSVILKLSNVNLQEKAYRDGLVEQLYDLTLEYLHSQAHCIGFPELVLPV VLQLKSFLRECKVANYCRQVQQLLGKVQENSAYICSRRQRVSFGVSEQQA VEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKR RKMADRKDEDRKQFKDLFDLNSSEEDDTEGFSERGILRPLSTRHGVEDDE EDEEEGEEDSSNSEDGDPDAEAGLAPGELQQLAQGPEDELEDLQLSEDD
    • Amino acids
      1 to 749
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NET15
    • NET7
    • NIR
    • NOC2 like
    • NOC2 like nucleolar associated transcriptional repressor
    • NOC2-like protein
    • NOC2L
    • NOC2L nucleolar associated transcriptional repressor
    • NOC2L_HUMAN
    • Novel INHAT (inhibitor of histone acetyltransferase) repressor
    • Novel INHAT repressor
    • Nucleolar complex associated 2 homolog (S. cerevisiae)
    • Nucleolar complex protein 2 homolog
    • PPP1R112
    • Protein NOC2 homolog
    • Protein phosphatase 1 regulatory subunit 12
    see all
  • Function
    Acts as an inhibitor of histone acetyltransferase activity; prevents acetylation of all core histones by the EP300/p300 histone acetyltransferase at p53/TP53-regulated target promoters in a histone deacetylases (HDAC)-independent manner. Acts as a transcription corepressor of p53/TP53- and TP63-mediated transactivation of the p21/CDKN1A promoter. Involved in the regulation of p53/TP53-dependent apoptosis. Associates together with TP63 isoform TA*-gamma to the p21/CDKN1A promoter.
  • Sequence similarities
    Belongs to the NOC2 family.
  • Cellular localization
    Nucleus > nucleoplasm. Nucleus > nucleolus. Translocates from the nucleoli to the nucleoplasm in presence of several stressors like ultraviolet irradiation and actinomycin-D. Predominantly detected in the nucleoli in non-mitotic cells. Predominantly detected in nucleoplasma in cells undergoing mitosis.
  • Information by UniProt

Images

  • ab161912 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up