Overview

  • Product name
    Recombinant Human NOC3L protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVE SSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH
    • Amino acids
      702 to 800
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AD24
    • AF233884
    • C10orf117
    • Factor for adipocyte differentiation 24
    • FAD24
    • FLJ12820
    • NOC3 like DNA replication regulator
    • NOC3 like protein
    • NOC3 protein homolog
    • NOC3-like protein
    • noc3l
    • NOC3L_HUMAN
    • Nucleolar complex associated 3 homolog (S. cerevisiae)
    • Nucleolar complex associated protein 3 like protein
    • Nucleolar complex protein 3 homolog
    • Nucleolar complex-associated protein 3-like protein
    • RGD1560656
    see all
  • Function
    May be required for adipogenesis.
  • Tissue specificity
    Expressed in colon, heart, kidney, liver, lung, placenta, skeletal muscle, small intestine, spleen and thymus.
  • Sequence similarities
    Belongs to the CBF/MAK21 family.
  • Cellular localization
    Nucleus > nucleolus. Nucleus speckle.
  • Information by UniProt

Images

  • ab163813 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up