Overview

  • Product name
    Recombinant Human NOC4L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEREPGAAGVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAV RTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCC NRLGELLGHPSFQVKELALSALLKFVQLEGAHPLEKSKWEGNYLFPRELF KLVVGGLLSPEEDQSLLLSQFREYLDYDDTRYHTMQAAVDAVARVTGQHP EVPPAFWNNAFTLLSAVSLPRREPTVSSFYVKRAELWDTWKVAHLKEHRR VFQAMWLSFLKHKLPLSLYKKVLLIVHDAILPQLAQPTLMIDFLTRACDL GGALSLLALNGLFILIHKHNLEYPDFYRKLYGLLDPSVFHVKYRARFFHL ADLFLSSSHLPAYLVAAFAKRLARLALTAPPEALLMVLPFICNLLRRHPA CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS KAASVINQALSMPEVSIAPLLELTAYEIFERDLKKKGPEPVPLEFIPAQG LLGRPGELCAQHFTLS
    • Amino acids
      1 to 516
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI326906
    • MGC28606
    • MGC3162
    • NET49
    • NOC4
    • NOC4 like protein
    • NOC4 protein homolog
    • NOC4-like protein
    • Noc4l
    • NOC4L_HUMAN
    • Nucleolar complex associated 4 homolog (S. cerevisiae)
    • Nucleolar complex protein 4 homolog
    • Nucleolar complex-associated protein 4 like protein
    • Nucleolar complex-associated protein 4-like protein
    • OTTMUSP00000032269
    • RGD1310661
    see all
  • Sequence similarities
    Belongs to the CBF/MAK21 family.
  • Cellular localization
    Nucleus membrane. Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab163972 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up