Recombinant Human Nociceptin receptor protein (ab159028)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRAL DVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQD YWG
    • Amino acids
      110 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H.sapiens mRNA for ORL1 receptor
    • Kappa type 3 opioid receptor
    • Kappa-type 3 opioid receptor
    • kappa3-related opioid receptor
    • KOR 3
    • KOR-3
    • KOR3
    • LC132 receptor like
    • LC132 receptor, rat, homolog of
    • MGC34578
    • Nociceptin receptor
    • Nociceptin/orphanin FQ (N/OFQ) peptide receptor
    • NOCIR
    • NOP
    • OOR
    • Opiate receptor like 1
    • Opiod receptor like 1
    • Oprl1
    • OPRX_HUMAN
    • ORL1
    • Orphanin FQ receptor
    see all
  • Function
    Receptor for the neuropeptide nociceptin/orphanin FQ. Has a potential role in modulating a number of brain functions, including instinctive behaviors and emotions. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159028 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up