Recombinant Human Nodal protein (ab114307)

Overview

  • Product name
    Recombinant Human Nodal protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSML YVDNGRVLLDHHKDMIVEECGC
    • Molecular weight
      34 kDa including tags
    • Amino acids
      275 to 346
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HTX5
    • MGC138230
    • Nodal
    • Nodal Growth Differentiation Factor
    • Nodal homolog
    • nodal homolog (mouse)
    • Nodal, Mouse, Homolog
    • NODAL_HUMAN
    see all
  • Function
    Essential for mesoderm formation and axial patterning during embryonic development.
  • Involvement in disease
    Defects in NODAL are the cause of visceral heterotaxy autosomal type 5 (HTX5) [MIM:270100]. A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy autosomal type 5 include situs inversus viscerum or situs ambiguus, congenital heart defect, transposition of the great vessels ventricular septal defect, atrial septal defect, truncuscommunis, and dextrocardia.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114307 Stained with Coomassie Blue.

References

ab114307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your enquiry and your interest in our products.

With regards to our recombinant protein (ab114307), could you please confirm the application(s) you wish to use the product in? I can confirm that this particular recombinant protei...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up