Recombinant Human Nogo B receptor protein (ab165100)

Overview

  • Product name
    Recombinant Human Nogo B receptor protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLA PLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVH MGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMD EILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADI VRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDST LGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
    • Amino acids
      1 to 293
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf68
    • MGC:7199
    • NgBR
    • NGBR_HUMAN
    • Nogo-B receptor
    • Nuclear undecaprenyl pyrophosphate synthase 1 homolog
    • nus1
    • TANGO14
    • Transport and golgi organization 14 homolog
    see all
  • Function
    Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Regulates the stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.
    Essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the UPP synthase family.
  • Cellular localization
    Endoplasmic reticulum membrane. Colocalizes with Nogo-B during VEGF and wound healing angiogenesis.
  • Information by UniProt

Images

  • ab165100 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up