Overview

  • Product name
    Recombinant Human NOL7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLE EDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKR REELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCE KGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYG PGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMV RKMKTKK
    • Amino acids
      1 to 257
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf90
    • dJ223E5.2
    • Nol7
    • NOL7_HUMAN
    • NOP27
    • Nucleolar protein 7
    • Nucleolar protein of 27 kDa
    • PQBP3
    • RARG-1
    see all
  • Tissue specificity
    Expressed in numerous tissues. Particularly prevalent in the adrenal gland, thyroid gland, heart and skeletal muscle.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab162542 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up