Overview

  • Product name
    Recombinant Human NOLA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQ IGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYK
    • Amino acids
      60 to 150
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gar1
    • GAR1_HUMAN
    • H/ACA ribonucleoprotein complex subunit 1
    • Nucleolar protein family A member 1
    • nucleolar protein family A member 1 (H/ACA small nucleolar RNPs)
    • snoRNP protein GAR1
    see all
  • Function
    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Sequence similarities
    Belongs to the GAR1 family.
  • Domain
    Interaction with SMN1 requires at least one of the RGG-box regions.
  • Cellular localization
    Nucleus, nucleolus. Nucleus, Cajal body. Also localized to Cajal bodies (coiled bodies).
  • Information by UniProt

Images

  • ab162737 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up