Overview

  • Product name
    Recombinant Human NOLC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRV ADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISV QVNSIKFDSE
    • Amino acids
      590 to 699
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 140 kDa nucleolar phosphoprotein
    • HCV NS5A trans regulated protein 13
    • HCV NS5A transactivated protein 13
    • HCV NS5A-transactivated protein 13
    • Hepatitis C virus NS5A transactivated protein 13
    • Hepatitis C virus NS5A-transactivated protein 13
    • KIAA0035
    • NOLC 1
    • NOLC1
    • NOLC1_HUMAN
    • NOPP 130
    • NOPP 140
    • NOPP130
    • Nopp140
    • NS5ATP13
    • Nucleolar 130 kDa protein
    • Nucleolar and coiled body phosphoprotein 1
    • Nucleolar and coiled body phosphprotein 1
    • Nucleolar and coiled-body phosphoprotein 1
    • Nucleolar phosphoprotein p130
    • Nucleolar protein p130
    • P130
    see all
  • Function
    Related to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I.
  • Sequence similarities
    Contains 1 LisH domain.
  • Post-translational
    modifications
    Undergoes rapid and massive phosphorylation/dephosphorylation cycles on CK2 and PKC sites. There is evidence suggesting that CDK1 kinase phosphorylates p130 at the M-phase.
  • Cellular localization
    Nucleus > nucleolus. Cytoplasm. Shuttles between the nucleolus and the cytoplasm. At telophase it begins to assemble into granular-like pre-nucleolar bodies which are subsequently relocated to nucleoli at the early G1-phase.
  • Information by UniProt

Images

  • ab160390 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up