Recombinant human Non Neuronal Enolase protein (ab167976)

Overview

  • Product name
    Recombinant human Non Neuronal Enolase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
    • Molecular weight
      47 kDa
    • Amino acids
      1 to 434

Specifications

Our Abpromise guarantee covers the use of ab167976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: > 13 units/ml. One unit will convert 1.0 µmole of 2-phosphoglycerate to phosphoenol pyruvate per minute at pH 7.5 at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.012% Magnesium sulphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 2-phospho-D-glycerate hydro-lyase
    • alpha enolase like 1
    • Alpha-enolase
    • bh3 interacting domain death agonist
    • C-myc promoter-binding protein
    • c-myc promoter-binding protein 1
    • c-myc promoter-binding protein-1
    • eno1
    • ENO1L1
    • ENOA_HUMAN
    • Enolase 1
    • enolase 1 (alpha)
    • HAP 47
    • HAP47
    • MBP-1
    • MPB 1
    • MPB-1
    • MPB1
    • MYC promoter-binding protein 1
    • NNE
    • Non-neural enolase
    • OTTHUMP00000001706
    • Phosphopyruvate hydratase
    • Plasminogen-binding protein
    • PPH
    • tau-crystallin
    see all
  • Function
    Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
    MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
  • Tissue specificity
    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similarities
    Belongs to the enolase family.
  • Developmental stage
    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Nucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.
  • Information by UniProt

Images

  • 15% SDS PAGE of ab167976 (3µg).

References

ab167976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Ratings

Abreviews
Application
Dot blot
used it for serum antibody binding assay. no complaints.
Username

Abcam user community

Verified customer

Submitted Jul 18 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up