Overview

  • Product name
    Recombinant Human NOP10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK RFKVLMTQQPRPVL
    • Amino acids
      1 to 64
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKCB1
    • H/ACA ribonucleoprotein complex subunit 3
    • homolog of yeast Nop10p
    • MGC70651
    • NOLA3
    • NOP10
    • NOP10 ribonucleoprotein homolog (yeast)
    • NOP10_HUMAN
    • NOP10P
    • Nucleolar protein 10
    • Nucleolar protein family A member 3
    • nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs)
    • snoRNP protein NOP10
    see all
  • Function
    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Involvement in disease
    Defects in NOP10 are a cause of dyskeratosis congenita autosomal recessive (ARDKC) [MIM:224230]. ARDKC is a rare, progressive bone marrow failure syndrome characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.
  • Sequence similarities
    Belongs to the NOP10 family.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > Cajal body. Also localized to Cajal bodies.
  • Information by UniProt

Images

  • ab153400 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up