Overview

  • Product name
    Recombinant Human NOR1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPK EDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEW LDSIKDFS
    • Molecular weight
      38 kDa including tags
    • Amino acids
      414 to 521

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHN
    • Chondrosarcoma, extraskeletal myxoid, fused to EWS
    • CSMF
    • MINOR
    • Mitogen induced nuclear orphan receptor
    • Mitogen-induced nuclear orphan receptor
    • Neuron derived orphan receptor
    • Neuron derived orphan receptor 1
    • Neuron-derived orphan receptor 1
    • NOR1
    • Nr4a3
    • NR4A3_HUMAN
    • Nuclear hormone receptor NOR-1
    • Nuclear hormone receptor NOR1
    • Nuclear receptor subfamily 4 group A member 3
    • TEC
    • Translocated in extraskeletal chondrosarcoma
    see all
  • Function
    Binds to the B1A response-element.
  • Tissue specificity
    Isoform alpha is highly expressed in skeletal muscle. Isoform beta is highly expressed in skeletal muscle and low expressed in fetal brain and placenta.
  • Involvement in disease
    Defects in NR4A3 are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving NR4A3 is found in patients with Erwing sarcoma. Translocation t(9;22)(q22-31;q11-12) with EWSR1.
    Note=A chromosomal aberration involving NR4A3 is a cause of a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with TAF2N.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR4 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152835 stained with Coomassie Blue.

References

ab152835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up