Recombinant Human NOSTRIN protein (ab165078)

Overview

  • Product name
    Recombinant Human NOSTRIN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQ KLASKLSKALQNTRKSCVSSAWAWASEGMKSTADLHQKLGKAIELEAIKP TYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKLMVSTKKHEAL FQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLK WENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHC AISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKS LLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYV KISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQ ARQDDELNLEKGDIVIIHEKKEEGWWFGSLNGKKGHFPAAYVEELPSNAG NTATKA
    • Amino acids
      1 to 506
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM247
    • BM247 homolog
    • DaIP2
    • eNOS-trafficking inducer
    • mDaIP2
    • MGC20702
    • Nitric oxide synthase traffic inducer
    • Nitric oxide synthase trafficker
    • NOSTN_HUMAN
    • Nostrin
    • RP23-431D4.2
    see all
  • Function
    Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.
  • Tissue specificity
    Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).
  • Sequence similarities
    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Domain
    The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
    The FCH domain is necessary for membrane targeting.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle. Cytoplasm > cytoskeleton. Enriched in selected actin structures.
  • Information by UniProt

Images

  • ab165078 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up