Recombinant Human Notch2 protein (ab114827)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ04721
    • SpeciesHuman
    • SequenceQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNG GTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSR DTYECTCQVG
    • Molecular weight38 kDa including tags
    • Amino acids27 to 136

Specifications

Our Abpromise guarantee covers the use of ab114827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGS2
    • hN2
    • Motch B
    • N2
    • N2ECD
    • N2ICD
    • neurogenic locus notch homolog protein 2
    • NOTC2_HUMAN
    • Notch 2
    • Notch 2 intracellular domain
    • Notch Drosophila homolog 2
    • Notch homolog 2
    • Notch homolog 2 Drosophila
    • Notch2
    see all
  • FunctionFunctions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs (By similarity). Involved in bone remodeling and homeostasis. In collaboration with RELA/p65 enhances NFATc1 promoter activity and positively regulates RANKL-induced osteoclast differentiation. Positively regulates self-renewal of liver cancer cells (PubMed:25985737).
  • Tissue specificityExpressed in the brain, heart, kidney, lung, skeletal muscle and liver. Ubiquitously expressed in the embryo.
  • Involvement in diseaseAlagille syndrome 2
    Hajdu-Cheney syndrome
  • Sequence similaritiesBelongs to the NOTCH family.
    Contains 6 ANK repeats.
    Contains 35 EGF-like domains.
    Contains 3 LNR (Lin/Notch) repeats.
  • Post-translational
    modifications
    Synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase in the trans-Golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin dependent gamma-secretase to release a notch-derived peptide containing the intracellular domain (NICD) from the membrane.
    Hydroxylated by HIF1AN.
    Can be either O-glucosylated or O-xylosylated at Ser-613 by POGLUT1.
  • Cellular localizationCell membrane and Nucleus. Cytoplasm. Following proteolytical processing NICD is translocated to the nucleus. Retained at the cytoplasm by C8orf4 (PubMed:25985737).
  • Information by UniProt

Recombinant Human Notch2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Notch2 protein (ab114827)

ab114827 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"