Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51513
    • SpeciesHuman
    • SequenceMMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQY FLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVC LIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRIKQT LPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQ SGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSC LNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAF PAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAA SANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFG AASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQEL TGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRA ANPQKVG
    • Molecular weight82 kDa including tags
    • Amino acids1 to 508

Specifications

Our Abpromise guarantee covers the use of ab114695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neuro oncological ventral antigen 1
    • Neuro-oncological ventral antigen 1
    • NOVA 1
    • Nova-1
    • Nova1
    • NOVA1_HUMAN
    • Onconeural ventral antigen 1
    • Paraneoplastic Ri antigen
    • RNA binding protein Nova 1
    • RNA-binding protein Nova-1
    • Ventral neuron specific protein 1
    • Ventral neuron-specific protein 1
    see all
  • FunctionMay regulate RNA splicing or metabolism in a specific subset of developing neurons.
  • Tissue specificityBrain.
  • Sequence similaritiesContains 3 KH domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Nova1 protein images

  • 12.5% SDS-PAGE showing ab114695 at approximately 81.51 kDa stained with Coomassie Blue.

References for Recombinant Human Nova1 protein (ab114695)

ab114695 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"