Overview

  • Product name
    Recombinant Human NOXA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLL AGDPEAALRAFDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFWLALE QLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTEAASSLREAMS KWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFL GKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLD AETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA GAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPV LYQVVAQHSYSAQGPEDLGFRQGDTVDVLCEEPDVPLAVDQAWLEGHCDG RIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP
    • Amino acids
      1 to 483
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen NY CO 31
    • Antigen NY-CO-31
    • FLJ25475
    • Inhibitory NADPH oxidase activator 1
    • MGC131800
    • NADPH oxidase activator 1
    • NCF2 like protein
    • NCF2-like protein
    • NOX activator 1
    • NOXA 1
    • Noxa1
    • NOXA1_HUMAN
    • NY CO 31
    • p51 nox
    • p51-nox
    • p51NOX
    • P67phox like factor
    • P67phox-like factor
    • SDCCAG31
    • Serologically defined colon cancer antigen 31
    see all
  • Function
    Functions as an activator of NOX1, a superoxide-producing NADPH oxidase. Functions in the production of reactive oxygen species (ROS) which participate in a variety of biological processes including host defense, hormone biosynthesis, oxygen sensing and signal transduction. May also activate CYBB/gp91phox and NOX3.
  • Tissue specificity
    Widely expressed. Detected in pancreas, liver, kidney, spleen, prostate, small intestine and colon.
  • Sequence similarities
    Belongs to the NCF2/NOXA1 family.
    Contains 1 OPR domain.
    Contains 1 SH3 domain.
    Contains 4 TPR repeats.
  • Developmental stage
    Expressed in fetal kidney.
  • Domain
    The SH3 domain mediates interaction with NOXO1 and NCF1 and has autoregulatory function.
    The TPR repeats mediate interaction with RAC1.
  • Post-translational
    modifications
    Interaction with YWHAZ depends on phosphorylation by PKA.
  • Cellular localization
    Cytoplasm. Cell membrane. Translocation to membranes depends on NOXO1 or NCF1 and maybe RAC1.
  • Information by UniProt

Images

  • ab161166 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up