Recombinant Human NOXA2/p67phox protein (ab117065)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19878
    • SpeciesHuman
    • SequenceMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTIL KNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQ LRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSM KSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLG KATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFG FVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR IHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEQTKLSYRPRDSN ELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQ TTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGECK GKVGIFPKVFVEDCATTDLESTRREV
    • Molecular weight84 kDa including tags
    • Amino acids1 to 526

Specifications

Our Abpromise guarantee covers the use of ab117065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 67 kDa neutrophil oxidase factor
    • Chronic granulomatous disease autosomal 2
    • FLJ93058
    • NADPH oxidase activator 2
    • NCF-2
    • Ncf2
    • NCF2_HUMAN
    • Neutrophil cytosol factor 2
    • Neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2)
    • Neutrophil NADPH oxidase factor 2
    • NOXA2
    • P67 PHOX
    • p67-phox
    • p67phox
    see all
  • FunctionNCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
  • Involvement in diseaseDefects in NCF2 are a cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 2 (CGD2) [MIM:233710]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similaritiesBelongs to the NCF2/NOXA1 family.
    Contains 1 OPR domain.
    Contains 2 SH3 domains.
    Contains 3 TPR repeats.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NOXA2/p67phox protein images

  • 12.5% SDS-PAGE showing ab117065 at approximately 83.86 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human NOXA2/p67phox protein (ab117065)

ab117065 has not yet been referenced specifically in any publications.

Product Wall

Vielen Dank für Ihre Anfrage. Gegen die genannten NADPH-Oxidase-Komponenten haben wir folgende Antikörper bzw. Proteine in unserem Katalog: Click here (or use the following: http://www.abcam.com/index.html?datasheet=109366). Click here (or use the...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"