Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSF LEDLATYETAFETGVSAFPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF
    • Amino acids
      704 to 802
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLH PAS type transcription factor NXF
    • bHLHe79
    • Class E basic helix-loop-helix protein 79
    • HLH-PAS transcription factor NXF
    • Le PAS
    • limbic enhanced PAS protein
    • neuronal PAS domain protein 4
    • Neuronal PAS domain-containing protein 4
    • Neuronal PAS4
    • NPAS4
    • NPAS4_HUMAN
    • NXF
    • PAS domain-containing protein 10
    • PASD10
    see all
  • Function
    Acts as a transcriptional activator in the presence of ARNT. Can activate the CME (CNS midline enhancer) element and the expression of the drebrin gene.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up