Overview

  • Product name
    Recombinant Human NPDC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRR PPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFS ARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDH HHHHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      35 to 181
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab194034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 99% Tris buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • AI314472
    • CAB1
    • Neural proliferation differentiation and control protein 1
    • NPDC-1
    • NPDC1
    • NPDC1_HUMAN
    see all
  • Function
    Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation.
  • Tissue specificity
    Strongly expressed in adult brain; especially in hippocampus, frontal lobe and temporal lobe.
  • Sequence similarities
    Belongs to the NPDC1/cab-1 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab194034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up