Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHK VDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHVSKAV QFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIE IKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSG TPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFP SPSKPVEPLNPKKKDSPML
    • Molecular weight
      30 kDa including tags
    • Amino acids
      125 to 383
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab188448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 95 % Densitometry.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: 0.02% DTT, 0.25% Sodium acetate

    Lyophilized in 30 mM acetate buffer.

  • Reconstitution
    Add 0.1 M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/mL. In higher concentrations the solubility of this antigen is limited.

General Info

  • Alternative names
    • nephrosis 2, idiopathic, steroid resistant
    • Nephrosis 2, idiopathic, steroid resistant (podocin)
    • NPHS2
    • NPHS2 gene
    • PDCN
    • PODO_HUMAN
    • Podocin
    • SRN1
    see all
  • Function
    Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.
  • Tissue specificity
    Almost exclusively expressed in the podocytes of fetal and mature kidney glomeruli.
  • Involvement in disease
    Defects in NPHS2 are the cause of nephrotic syndrome type 2 (NPHS2) [MIM:600995]. It is a renal disorder characterized clinically by childhood onset of proteinuria, hypoalbuminemia, hyperlipidemia, and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. The disorder is resistant to steroid treatment and progresses to end-stage renal failure in the first or second decades. Some patients show later onset of the disorder.
  • Sequence similarities
    Belongs to the band 7/mec-2 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab188448.

    Lane 1: Reduced and boiled sample, 2.5 μg

    Lane 2: Non-reduced and non-boiled sample, 2.5 μg

References

ab188448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up