Overview

  • Product name
    Recombinant Human NPL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAFPKKKLQGLVAATITPMTENGEINFSVI GQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQ VIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKE VAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLL DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQM LEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 320
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106873 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 0610033B02Rik
    • C112
    • C1orf13
    • Dihydrodipicolinate synthase
    • Dihydrodipicolinate synthetase homolog 1
    • MGC149582
    • MGC61869
    • N-acetylneuraminate lyase
    • N-acetylneuraminate pyruvate-lyase
    • N-acetylneuraminic acid aldolase
    • NAL
    • NALase
    • NPL
    • NPL_HUMAN
    • NPL1
    • RP11-249O6.1
    • Sialate lyase
    • Sialate-pyruvate lyase
    • Sialic acid aldolase
    • Sialic acid lyase
    see all
  • Function
    Catalyzes the cleavage of N-acetylneuraminic acid (sialic acid) to form pyruvate and N-acetylmannosamine via a Schiff base intermediate. It prevents sialic acids from being recycled and returning to the cell surface.
  • Tissue specificity
    Isoform 2 is expressed in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocyte.
  • Pathway
    Amino-sugar metabolism; N-acetylneuraminate degradation; D-fructose 6-phosphate from N-acetylneuraminate: step 1/5.
  • Sequence similarities
    Belongs to the DHDPS family. NanA subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NPL protein images

  • 15% SDS-PAGE analysis of 3µg ab106873.

References for Recombinant Human NPL protein (ab106873)

ab106873 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up