Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINR NKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVF GAPNVVEDE
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1499
    • NPL4
    • NPL4, S. cerevisiae, homolog of
    • NPL4_HUMAN
    • nploc4
    • Nuclear protein localization 4 homolog
    • nuclear protein localization 4 homolog (S. cerevisiae)
    • Nuclear protein localization protein 4 homolog
    • Nuclear protein localization protein 4, S. cerevisiae, homolog of
    • Protein NPL4
    see all
  • Function
    The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope.
  • Tissue specificity
    Expressed at highest levels in brain, heart, skeletal muscle, kidney and fetal liver.
  • Pathway
    Protein degradation; proteasomal ubiquitin-dependent pathway.
  • Sequence similarities
    Belongs to the NPL4 family.
    Contains 1 RanBP2-type zinc finger.
  • Domain
    Binds ubiquitinated proteins via its RanBP2-type zinc finger.
  • Cellular localization
    Cytoplasm > cytosol. Endoplasmic reticulum. Nucleus. Associated with the endoplasmic reticulum and nuclear.
  • Information by UniProt

Images

  • ab153406 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up