Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTE QL
    • Amino acids
      2 to 53
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASRT2
    • G protein coupled receptor 154
    • G protein coupled receptor for asthma susceptibility
    • G protein coupled receptor PGR14
    • GPR 154
    • gpr154
    • GPRA
    • MVTR
    • Neuropeptide S receptor
    • Neuropeptide S receptor 1
    • nps receptor
    • NPSR
    • NPSR 1
    • NPSR1
    • PGR 14
    • PGR14
    • Vasopressin receptor related receptor 1
    • VRR 1
    • VRR1
    see all
  • Relevance
    Neuropeptide S receptor 1 (GPR154) is a receptor for Neuropeptide S. It is expressed on the epithelia of several organs including the intestine, and appears to be upregulated in inflammation. It is upregulated in macrophages after antigen challenge and is involved in the pathogenesis of asthma and other IgE-mediated diseases.
  • Cellular localization
    Cell Membrane and Cytoplasmic

Images

  • ab153648 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up