Overview

  • Product name
    Recombinant Human NPTX2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQG GAQSPEEELRAAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGG KARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLESLEHQLRANVS NAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTES TLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAF TICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQL PLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPG NIIPWVDNNVDVFGGASKWPVETCEERLLDL
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 431

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • apexin
    • NARP
    • neuronal activity-regulated pentaxin
    • Neuronal pentraxin 2
    • Neuronal pentraxin II
    • Neuronal pentraxin-2
    • NP 2
    • NP-II
    • NP2
    • NPII
    • NPTX2
    • NPTX2_HUMAN
    • pentraxin II, neuronal
    see all
  • Function
    Likely to play role in the modification of cellular properties that underlie long-term plasticity. Binds to agar matrix in a calcium-dependent manner.
  • Tissue specificity
    Brain, pancreas, liver, heart and skeletal muscle. Highest levels are seen in the testis.
  • Sequence similarities
    Contains 1 pentaxin domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152578 stained with Coomassie Blue.

References

ab152578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up