Recombinant Human NRAMP1 protein (ab159531)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
    • Amino acids
      308 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LSH
    • Natural resistance associated macrophage protein 1
    • Natural resistance-associated macrophage protein 1
    • NRAM1_HUMAN
    • NRAMP
    • NRAMP 1
    • PBC
    • SLC11A1
    • Solute carrier family 11 (proton coupled divalent metal ion transporters) member 1
    • solute carrier family 11 (sodium/phosphate symporters) member 1
    • Solute carrier family 11 member 1
    see all
  • Function
    Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe(2+) and Mn(2+), cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.
  • Tissue specificity
    Macrophages; peripheral blood leukocytes, lung, spleen and liver.
  • Sequence similarities
    Belongs to the NRAMP family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159531 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up