Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92823-4
    • SpeciesHuman
    • SequenceYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLI INIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPI TLQSGQSLVL
    • Molecular weight38 kDa including tags
    • Amino acids50 to 159
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Bravo
    • hBravo
    • Neuronal cell adhesion molecule
    • Neuronal surface protein Bravo
    • Ng CAM related
    • Ng-CAM-related
    • NgCAM related cell adhesion molecule
    • NgCAM-related cell adhesion molecule
    • Nr CAM
    • Nr-CAM
    • Nrcam
    • NRCAM_HUMAN
    see all
  • FunctionCell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.
  • Tissue specificityDetected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.
    Contains 5 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human NrCAM protein images

  • ab112333 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human NrCAM protein (ab112333)

ab112333 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"