Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16656
    • SpeciesHuman
    • SequenceTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTE EQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
    • Molecular weight35 kDa including tags
    • Amino acids201 to 285
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • alpha pal
    • alpha palindromic binding protein
    • Alpha palindromic-binding protein
    • Alpha-pal
    • locus control region factor 1
    • NFE2 related factor 1
    • NRF-1
    • Nrf1
    • NRF1_HUMAN
    • Nuclear respiratory factor 1
    see all
  • FunctionTranscription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication.
  • Tissue specificityUbiquitously expressed with strongest expression in skeletal muscle.
  • Sequence similaritiesBelongs to the NRF1/Ewg family.
  • Post-translational
    modifications
    Phosphorylation enhances DNA binding.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NRF1 protein images

  • ab112334 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human NRF1 protein (ab112334)

ab112334 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"